General Information

  • ID:  hor001098
  • Uniprot ID:  A0A921YVE1
  • Protein name:  FLRFamide
  • Gene name:  NA
  • Organism:  Manduca sexta (Tobacco hawkmoth) (Tobacco hornworm)
  • Family:  FMRFamide related peptide family
  • Source:  animal
  • Expression:  in the middle and posterior regions of the midgut
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Manduca (genus), Sphingini (tribe), Sphinginae (subfamily), Sphingidae (family), Bombycoidea (superfamily), Obtectomera, Ditrysia, Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  YAEAAGEQVPEYQALVRDYPQLLDSGMKRQDVVHSFLRF
  • Length:  39
  • Propeptide:  MNVIGEHCRFALVCVVMCWLVSVVVCAPAQLCAGAAEDDPRAARFCQALNTFLELYAEAAGEQVPEYQALVRDYPQLLDSGMKRQDVVHSFLRFGRRR
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001098_AF2.pdbhor001098_ESM.pdb

Physical Information

Mass: 520607 Formula: C203H309N55O61S
Absent amino acids: CINTW Common amino acids: ALQV
pI: 4.73 Basic residues: 5
Polar residues: 7 Hydrophobic residues: 14
Hydrophobicity: -47.18 Boman Index: -7767
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 80
Instability Index: 6249.74 Extinction Coefficient cystines: 4470
Absorbance 280nm: 117.63

Literature

  • PubMed ID:  9359469
  • Title:  Identification of Neuropeptides in the Midgut of Parasitized Insects: FLRFamides as Candidate Paracrines